PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr4P01350_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 255aa    MW: 28225.9 Da    PI: 8.2837
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr4P01350_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.71.9e-18114168256
                            T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                            rk+ ++tkeq   Le+ F+++  ++ ++++ LAk+l+L  rqV vWFqNrRa+ k
  GSMUA_Achr4P01350_001 114 RKKLRLTKEQSAMLENRFKEHTSLNPKQKQALAKQLNLRPRQVEVWFQNRRARTK 168
                            678899***********************************************98 PP

2HD-ZIP_I/II120.96.6e-39114201188
            HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                            +kk+rl+keq+++LE+ F+e++ L+p++K++la++L+l+prqv+vWFqnrRARtk+kq+E+d+e L+r+y++l++en+rL+ke +e++
  GSMUA_Achr4P01350_001 114 RKKLRLTKEQSAMLENRFKEHTSLNPKQKQALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEILRRCYEKLTAENQRLRKELQEMK 201
                            69***********************************************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.75E-18109171IPR009057Homeodomain-like
PROSITE profilePS5007116.876110170IPR001356Homeobox domain
SMARTSM003892.7E-14112174IPR001356Homeobox domain
CDDcd000863.16E-16114171No hitNo description
PfamPF000467.5E-16114168IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.2E-18114168IPR009057Homeodomain-like
PROSITE patternPS000270145168IPR017970Homeobox, conserved site
PfamPF021835.6E-11170203IPR003106Leucine zipper, homeobox-associated
SMARTSM003402.0E-16170215IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MDINNSQDIR ETALSLGLGV GPTTTTSAEH LRPREPCSPL TNLASDQPSL ALSLSTDAYA  60
ETAKAKEESR PAPASSSRSA VSSFSSPHAT IVLREKDVGS DEAEEDEEDN GCVRKKLRLT  120
KEQSAMLENR FKEHTSLNPK QKQALAKQLN LRPRQVEVWF QNRRARTKLK QTEVDCEILR  180
RCYEKLTAEN QRLRKELQEM KSLRFSAPSP LYMQIPAATL ALCPSCQRIN GSEAGSDAAP  240
KPGLFLNPIT HPAPC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1162170RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009395018.10.0PREDICTED: homeobox-leucine zipper protein HOX19-like
SwissprotA2XE761e-64HOX19_ORYSI; Homeobox-leucine zipper protein HOX19
SwissprotQ8GRL41e-64HOX19_ORYSJ; Homeobox-leucine zipper protein HOX19
TrEMBLM0SK520.0M0SK52_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr4P01350_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20553698
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.14e-61HD-ZIP family protein